PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN11630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 237aa    MW: 26936.3 Da    PI: 7.9052
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN11630.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.5e-17956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++ Ed+ll+ +v+++G g+W++++++ g++R++k+c++rw++yl
       KHN11630.1  9 KGTWSQIEDDLLKACVQLYGEGNWHLVPKRAGLNRCRKSCRLRWLNYL 56
                     799*******************************************97 PP

2Myb_DNA-binding46.77.1e-1562106147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg ++++E +  ++++k+lG++ W++Ia +++ gRt +++k++w++y
       KHN11630.1  62 RGDFSEDEIDMMIRLHKLLGNR-WSLIAGRLP-GRTSNDVKNYWNTY 106
                      899*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.437460IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-21559IPR009057Homeodomain-like
SuperFamilySSF466891.45E-276103IPR009057Homeodomain-like
SMARTSM007172.3E-15858IPR001005SANT/Myb domain
PfamPF002491.0E-15956IPR001005SANT/Myb domain
CDDcd001672.68E-101156No hitNo description
Gene3DG3DSA:1.10.10.601.8E-2260111IPR009057Homeodomain-like
PROSITE profilePS5129418.45561111IPR017930Myb domain
SMARTSM007171.2E-1361109IPR001005SANT/Myb domain
PfamPF002491.8E-1362106IPR001005SANT/Myb domain
CDDcd001671.36E-965106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MEGSSGVRKG TWSQIEDDLL KACVQLYGEG NWHLVPKRAG LNRCRKSCRL RWLNYLKPNI  60
KRGDFSEDEI DMMIRLHKLL GNRWSLIAGR LPGRTSNDVK NYWNTYARRK LHSHKKDNNI  120
EKQARAKTTV KPHEVIKPVP RALTKTSPRL QGKFINSSEV GVSHEEGATS ISGSGNWWET  180
FLDDKEDIEE GNNNKCFFGG EDGALDLWGE ELNSIACDFL TQGETWSDFL LDLGLGD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-2331111108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB9342800.0AB934280.1 Glycine max gene for MYB transcription factor, complete cds, allele: R, cultivar: Clark.
GenBankAB9342810.0AB934281.1 Glycine max gene for MYB transcription factor, complete cds, allele: r-m.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003533530.11e-176PREDICTED: transcription factor MYB90-like
SwissprotQ9FNV93e-56MY113_ARATH; Transcription factor MYB113
TrEMBLA0A0B2PRD51e-176A0A0B2PRD5_GLYSO; Transcription factor MYB113
TrEMBLK7LFP21e-176K7LFP2_SOYBN; MYB transcription factor
STRINGGLYMA09G36983.11e-176(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.12e-57myb domain protein 113
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]